Forskning
Udskriv Udskriv
Switch language
Region Hovedstaden - en del af Københavns Universitetshospital
Udgivet

Degradable dendritic nanogels as carriers for antimicrobial peptides

Publikation: Bidrag til tidsskriftTidsskriftartikelForskningpeer review

DOI

  1. Multiscale modeling of innate immune receptors: Endotoxin recognition and regulation by host defense peptides

    Publikation: Bidrag til tidsskriftReviewForskningpeer review

  2. Carbonic anhydrases in human keratinocytes and their regulation by all-trans retinoic acid and 1α,25-dihydroxyvitamin D3

    Publikation: Bidrag til tidsskriftTidsskriftartikelForskningpeer review

  3. Variability in the diagnosis of surgical-site infections after full-thickness skin grafting: an international survey

    Publikation: Bidrag til tidsskriftTidsskriftartikelForskningpeer review

  4. Prevalence of chronic wounds in the general population: systematic review and meta-analysis of observational studies

    Publikation: Bidrag til tidsskriftTidsskriftartikelForskningpeer review

  5. Inflammation Biomarkers and Correlation to Wound Status After Full-Thickness Skin Grafting

    Publikation: Bidrag til tidsskriftTidsskriftartikelForskningpeer review

  • Randi Nordström
  • Oliver C J Andrén
  • Shalini Singh
  • Michael Malkoch
  • Mina Davoudi
  • Artur Schmidtchen
  • Martin Malmsten
Vis graf over relationer

In the present study, we investigate degradable anionic dendritic nanogels (DNG) as carriers for antimicrobial peptides (AMPs). In such systems, the dendritic part contains carboxylic acid-based anionic binding sites for cationic AMPs, whereas linear poly(ethylene glycol) (PEG) chains form a shell for promotion of biological stealth. In order to clarify factors influencing membrane interactions of such systems, we here address effects of nanogel charge, cross-linking, and degradation on peptide loading/release, as well as consequences of these factors for lipid membrane interactions and antimicrobial effects. The DNGs were found to bind the AMPs LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW). For the smaller DPK-060 peptide, loading was found to increase with increasing nanogel charge density. For the larger LL-37, on the other hand, peptide loading was largely insensitive to nanogel charge density. In line with this, results on the secondary structure, as well as on the absence of stabilization from proteolytic degradation by the nanogels, show that the larger LL-37 is unable to enter into the interior of the nanogels. While 40-60% nanogel degradation occurred over 10 days, promoted at high ionic strength and lower cross-linking density/higher anionic charge content, peptide release at physiological ionic strength was substantially faster, and membrane destabilization not relying on nanogel degradation. Ellipsometry and liposome leakage experiments showed both free peptide and peptide/DNG complexes to cause membrane destabilization, indicated also by antimicrobial activities being comparable for nanogel-bound and free peptide. Finally, the DNGs were demonstrated to display low toxicity towards erythrocytes even at peptide concentrations of 100 µM.

OriginalsprogEngelsk
TidsskriftJournal of colloid and interface science
Vol/bind554
Sider (fra-til)592-602
Antal sider11
ISSN0021-9797
DOI
StatusUdgivet - 15 okt. 2019

Bibliografisk note

Copyright © 2019 Elsevier Inc. All rights reserved.

ID: 59237753